PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa04g005360.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family BBR-BPC
Protein Properties Length: 289aa    MW: 32137.6 Da    PI: 10.2869
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa04g005360.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind363.63.9e-11112881301
       GAGA_bind   1 mdddgsrernkgyyepa.aslkenlglqlmssiaerdaki....rernlalsekkaavaerd......maflqrdkalaernkalverdnkllal 84 
                     mdddg+  rn+gyyepa a++k nlglqlms+i +r++k+    re+nl ++++++++++r+      m++    +++++      ++dnk++++
  Csa04g005360.1   1 MDDDGF--RNWGYYEPAaATFKGNLGLQLMSTI-DRNTKPflpgRESNL-MIGSNGSYHPREheasmpMNY----SWINQ------PKDNKFFNM 81 
                     99**99..9*******999**************.9**************.************998888888....*****......********* PP

       GAGA_bind  85 llvenslasalpvgvqvlsgtksidslqqlse.....pqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkkseks 174
                     l++++      p++++v+s+t+  +s+q++++     +++e+++++ + +    + +++ ++++ k++k++ + ++++ pk+kk +k+k++s   
  Csa04g005360.1  82 LPIST------PNYSNVMSETSGSNSMQMMHQsvvttSRFEENPIQPPPS---REDETV-QQPSGKKRKMRGSMATPTAPKAKKPRKPKEES--- 163
                     **766......9999**************988444444444444442222...222222.24556666666666777777777777777733... PP

       GAGA_bind 175 kkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklL 269
                        v+++ +++r+k +kks+d+v+ngvs+D+s+lPvPvC+CtG+++qCY+WG+GGWqSaCCtt+iS+yPLP+stkrrgaRi+grKmSqgafkk+L
  Csa04g005360.1 164 --GVTNNVQQQRVKPPKKSVDVVINGVSMDISGLPVPVCTCTGTPQQCYRWGCGGWQSACCTTNISMYPLPMSTKRRGARISGRKMSQGAFKKVL 256
                     ..44455555789********************************************************************************** PP

       GAGA_bind 270 ekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                     ekLa+eGy+++n++DLk+hWA+HGtnkfvtir
  Csa04g005360.1 257 EKLATEGYSFGNAIDLKSHWARHGTNKFVTIR 288
                     *******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012266.3E-1711288IPR010409GAGA-binding transcriptional activator
PfamPF062178.8E-1041288IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MDDDGFRNWG YYEPAAATFK GNLGLQLMST IDRNTKPFLP GRESNLMIGS NGSYHPREHE  60
ASMPMNYSWI NQPKDNKFFN MLPISTPNYS NVMSETSGSN SMQMMHQSVV TTSRFEENPI  120
QPPPSREDET VQQPSGKKRK MRGSMATPTA PKAKKPRKPK EESGVTNNVQ QQRVKPPKKS  180
VDVVINGVSM DISGLPVPVC TCTGTPQQCY RWGCGGWQSA CCTTNISMYP LPMSTKRRGA  240
RISGRKMSQG AFKKVLEKLA TEGYSFGNAI DLKSHWARHG TNKFVTIR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2545890.0AC254589.1 Capsella rubella clone CAP16-D05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010502201.10.0PREDICTED: protein BASIC PENTACYSTEINE1-like
SwissprotQ9SKD00.0BPC1_ARATH; Protein BASIC PENTACYSTEINE1
TrEMBLR0HH840.0R0HH84_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.5__107__AT2G01930.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28932769
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01930.21e-171basic pentacysteine1